Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target6-phospho-1-fructokinase
LigandBDBM50320388
Substrate/Competitorn/a
Meas. Tech.ChEMBL_634094
Ki 9000±n/a nM
Citation Ngantchou, INyasse, BDenier, CBlonski, CHannaert, VSchneider, B Antitrypanosomal alkaloids from Polyalthia suaveolens (Annonaceae): their effects on three selected glycolytic enzymes of Trypanosoma brucei. Bioorg Med Chem Lett20:3495-8 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
6-phospho-1-fructokinase
Name:6-phospho-1-fructokinase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:53537.94
Organism:Trypanosoma brucei
Description:ChEMBL_1288121
Residue:487
Sequence:
MAVESRSRVTSKLVKAHRAMLNSVTQEDLKVDRLPGADYPNPSKKYSSRTEFRDKTDYIM
YNPRPRDEPSSENPVSVSPLLCELAAARSRIHFNPTETTIGIVTCGGICPGLNDVIRSIT
LTGINVYNVKRVIGFRFGYWGLSKKGSQTAIELHRGRVTNIHHYGGTILGSSRGPQDPKE
MVDTLERLGVNILFTVGGDGTQRGALVISQEAKRRGVDISVFGVPKTIDNDLSFSHRTFG
FQTAVEKAVQAIRAAYAEAVSANYGVGVVKLMGRDSGFIAAQAAVASAQANICLVPENPI
SEQEVMSLLERRFCHSRSCVIIVAEGFGQDWGRGSGGYDASGNKKLIDIGVILTEKVKAF
LKANKSRYPDSTVKYIDPSYMIRACPPSANDALFCATLATLAVHEAMAGATGCIIAMRHN
NYILVPIKVATSVRRVLDLRGQLWRQVREITVDLGSDVRLARKLEIRRELEAINRNRDRL
HEELAKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50320388
NameBDBM50320388
Synonyms:CHEMBL1083627 | polysin
TypeSmall organic molecule
Emp. Form.C23H29NO
Mol. Mass.335.4825
SMILESC[C@@]12CC[C@H]3C(C)(C)C(=O)CC[C@]3(C)[C@@H]1Cc1cc3ccccc3n21 |r|
Structure
n/a