Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase III
LigandBDBM50323739
Substrate/Competitorn/a
Meas. Tech.ChEMBL_646955
Ki 520±n/a nM
Citation Carta, FTemperini, CInnocenti, AScozzafava, AKaila, KSupuran, CT Polyamines inhibit carbonic anhydrases by anchoring to the zinc-coordinated water molecule. J Med Chem53:5511-22 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic Anhydrase III
Name:Carbonic Anhydrase III
Synonyms:CA-III | Carbonate dehydratase III | Carbonic anhydrase 3 (CA III) | Carbonic anhydrase III (CA III)
Type:Enzyme
Mol. Mass.:29562.11
Organism:Homo sapiens (human)
Description:Human cloned isozyme.
Residue:260
Sequence:
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDP
SCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPL
VSNWRPPQPINNRVVRASFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50323739
NameBDBM50323739
Synonyms:CHEMBL1214194 | N1,N1'-(ethane-1,2-diyl)bis(N1,N2,N2-trimethylethane-1,2-diamine)
TypeSmall organic molecule
Emp. Form.C12H30N4
Mol. Mass.230.3934
SMILESCN(C)CCN(C)CCN(C)CCN(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a