Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine palmitoyltransferase 1
LigandBDBM50325998
Substrate/Competitorn/a
Meas. Tech.ChEMBL_660503
IC50 10±n/a nM
Citation Sakamoto, HOkamoto, KAoki, MKato, HKatsume, AOhta, ATsukuda, TShimma, NAoki, YArisawa, MKohara, MSudoh, M Host sphingolipid biosynthesis as a target for hepatitis C virus therapy. Nat Chem Biol1:333-7 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine palmitoyltransferase 1
Name:Serine palmitoyltransferase 1
Synonyms:LCB 1 | Long chain base biosynthesis protein 1 | SPT 1 | SPT1 | Serine-palmitoyl-CoA transferase 1
Type:PROTEIN
Mol. Mass.:52739.30
Organism:Homo sapiens (Human)
Description:ChEMBL_660503
Residue:473
Sequence:
MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEEL
IEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAA
ALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSK
RGDIVFVDRAACFAIQKGLQASRSDIKLFKHNDMADLERLLKEQEIEDQKNPRKARVTRR
FIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDI
DLISANMENALASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENP
GIFAVLKEKCGQIHKALQGISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCM
NRSIALTQARYLEKEEKCLPPPSIRVVVTVEQTEEELERAASTIKEVAQAVLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50325998
NameBDBM50325998
Synonyms:(S)-2-((S,E)-1-((S)-1-carboxy-2-(4-(3-methylbut-2-enyloxy)phenyl)ethylamino)-1,11-dioxooctadec-3-en-2-yl)-2-hydroxysuccinic acid | CHEMBL1241090
TypeSmall organic molecule
Emp. Form.C36H53NO10
Mol. Mass.659.8067
SMILES[#6]-[#6]-[#6]-[#6]-[#6]-[#6]-[#6]-[#6](=O)-[#6]-[#6]-[#6]-[#6]-[#6]-[#6]\[#6]=[#6]\[#6@H](-[#6](=O)-[#7]-[#6@@H](-[#6]-c1ccc(-[#8]-[#6]\[#6]=[#6](\[#6])-[#6])cc1)-[#6](-[#8])=O)[C@@]([#8])([#6]-[#6](-[#8])=O)[#6](-[#8])=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a