Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTranscription factor AP-1
LigandBDBM50326017
Substrate/Competitorn/a
Meas. Tech.ChEMBL_654663
Kd 10000±n/a nM
Citation Luedtke, NWDexter, RJFried, DBSchepartz, A Surveying polypeptide and protein domain conformation and association with FlAsH and ReAsH. Nat Chem Biol3:779-84 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Transcription factor AP-1
Name:Transcription factor AP-1
Synonyms:AP1 | Activator protein 1 | JUN | Proto-oncogene c-JUN | Transcription factor AP1 | V-jun avian sarcoma virus 17 oncogene homolog | p39
Type:n/a
Mol. Mass.:35683.24
Organism:Homo sapiens (Human)
Description:P05412
Residue:331
Sequence:
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50326017
NameBDBM50326017
Synonyms:Ac-WRIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVCC-NH2 | CHEMBL1241036
TypeSmall organic molecule
Emp. Form.C200H344N62O59S3
Mol. Mass.4657.446
SMILESn/a
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a