Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium/glucose cotransporter 2 (SGLT2)
LigandBDBM20877
Substrate/Competitorn/a
Meas. Tech.ChEMBL_659926
IC50 5.2±n/a nM
Citation Nomura, SSakamaki, SHongu, MKawanishi, EKoga, YSakamoto, TYamamoto, YUeta, KKimata, HNakayama, KTsuda-Tsukimoto, M Discovery of canagliflozin, a novel C-glucoside with thiophene ring, as sodium-dependent glucose cotransporter 2 inhibitor for the treatment of type 2 diabetes mellitus. J Med Chem53:6355-60 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sodium/glucose cotransporter 2 (SGLT2)
Name:Sodium/glucose cotransporter 2 (SGLT2)
Synonyms:Na(+)/glucose cotransporter 2 | Sodium-Dependent Glucose Cotransporter 2 (SGLT2) | Sodium-dependent glucose cotransporter 2 (SGLT2) | Sodium/glucose cotransporter 1 (SGLT1) | Sodium/glucose cotransporter 2 | Solute carrier family 5 member 2
Type:Protein
Mol. Mass.:72902.00
Organism:Homo sapiens (Human)
Description:P31639
Residue:672
Sequence:
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGR
SMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTA
GVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIA
LLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSL
TVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR
CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVG
CSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR
ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRV
NEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLL
TLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ
APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLM
MAVAVFLWGFYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM20877
NameBDBM20877
Synonyms:3-(1-benzofuran-5-yl)-1-(2-hydroxy-4-methyl-6-{[(2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy}phenyl)propan-1-one | CHEMBL183937 | JMC511145 Compound 2 | O-glucoside, 2 | T-1095A
TypeSmall organic molecule
Emp. Form.C24H26O9
Mol. Mass.458.4578
SMILESCc1cc(O)c(C(=O)CCc2ccc3occc3c2)c(O[C@@H]2O[C@H](CO)[C@@H](O)[C@H](O)[C@H]2O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a