Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOxytocin receptor
LigandBDBM50326722
Substrate/Competitorn/a
Meas. Tech.ChEMBL_661577
Ki 0.65±n/a nM
Citation Borthwick, AD Oral oxytocin antagonists. J Med Chem53:6525-38 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Oxytocin receptor
Name:Oxytocin receptor
Synonyms:OT-R | Oxytocin
Type:Enzyme Catalytic Domain
Mol. Mass.:42793.26
Organism:HEK293
Description:Oxytocin OXTR HEK293::B2R9L7
Residue:389
Sequence:
MEGALAANWSAEAANASAAPPGAEGNRTAGPPRRNEALARVEVAVLCLILLLALSGNACV
LLALRTTRQKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLATWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYITWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AEAPEGAAAGDGGRVALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVW
DANAPKEASAFIIVMLLASLNSCCNPWIYMLFTGHLFHELVQRFLCCSASYLKGRRLGET
SASKKSNSSSFVLSHRSSSQRSCSQPSTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50326722
NameBDBM50326722
Synonyms:(Z)-3-(4-(N-(4-chlorophenyl)-N-(2-oxo-2-(2-(2-oxoindolin-3-ylidene)hydrazinyl)ethyl)sulfamoyl)phenyl)-N-(3-(dimethylamino)propyl)propanamide | 3-(4-(N-(4-chlorophenyl)-N-(2-oxo-2-(2-(2-oxoindolin-3-ylidene)hydrazinyl)ethyl)sulfamoyl)phenyl)-N-(3-(dimethylamino)propyl)propanamide | CHEMBL445816
TypeSmall organic molecule
Emp. Form.C30H33ClN6O5S
Mol. Mass.625.138
SMILESCN(C)CCCNC(=O)CCc1ccc(cc1)S(=O)(=O)N(CC(=O)N\N=C1/C(=O)Nc2ccccc12)c1ccc(Cl)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a