Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEcdysone receptor
LigandBDBM50326773
Substrate/Competitorn/a
Meas. Tech.ChEMBL_661762
IC50 12500±n/a nM
Citation Birru, WFernley, RTGraham, LDGrusovin, JHill, RJHofmann, AHowell, LJames, PJJarvis, KEJohnson, WMJones, DALeitner, CLiepa, AJLovrecz, GOLu, LNearn, RHO'Driscoll, BJPhan, TPollard, MTurner, KAWinkler, DA Synthesis, binding and bioactivity of gamma-methylene gamma-lactam ecdysone receptor ligands: advantages of QSAR models for flexible receptors. Bioorg Med Chem18:5647-60 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ecdysone receptor
Name:Ecdysone receptor
Synonyms:20-hydroxy-ecdysone receptor | 20E receptor | EcRH | Ecdysteroid receptor | Nuclear receptor subfamily 1 group H member 1
Type:PROTEIN
Mol. Mass.:82587.92
Organism:Lucilia cuprina
Description:ChEMBL_661762
Residue:757
Sequence:
MMKRRWSNNGGFAALKMLEESSSEVTSSSNGLVLSSDINMSPSSLDSPVYGDQEMWLCND
SASYNNSHQHSVITSLQGCTSSLPAQTTIIPLSALPNSNNASLNNQNQNYQNGNSMNTNL
SVNTNNSVGGGGGGGGVPGMTSLNGLGGGGGSQVNNHNHSHNHLHHNSNSNHSNSSSHHT
NGHMGIGGGGGGLSVNINGPNIVSNAQQLNSLQASQNGQVIHANIGIHSIISNGLNHHHH
HHMNNSSMMHHTPRSESANSISSGRDDLSPSSSLNGFSTSDASDVKKIKKGPAPRLQEEL
CLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAVYCCKFGHACEMDMYMRRKCQECRLKK
CLAVGMRPECVVPENQCAMKRREKKAQKEKDKIQTSVCATEIKKEILDLMTCEPPSHPTC
PLLPEDILAKCQARNIPPLSYNQLAVIYKLIWYQDGYEQPSEEDLKRIMSSPDENESQHD
ASFRHITEITILTVQLIVEFAKGLPAFTKIPQEDQITLLKACSSEVMMLRMARRYDHNSD
SIFFANNRSYTRDSYKMAGMADNIEDLLHFCRQMYSMKVDNVEYALLTAIVIFSDRPGLE
EAELVEAIQSYYIDTLRIYILNRHCGDPMSLVFFAKLLSILTELRTLGNQNAEMCFSLKL
KNRKLPKFLEEIWDVHAIPPSVQSHIQATQAEKAAQEAQATTSAISAAATSSSSINTSMA
TSSSSSLSPSAASTPNGGAVDYVGTDMSMSLVQSDNA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50326773
NameBDBM50326773
Synonyms:1-cyclohexyl-5-methylene-2-oxo-4-phenyl-2,5-dihydro-1H-pyrrole-3-carbonitrile | CHEMBL1254214
TypeSmall organic molecule
Emp. Form.C18H18N2O
Mol. Mass.278.3483
SMILESC=C1N(C2CCCCC2)C(=O)C(C#N)=C1c1ccccc1 |c:14|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a