Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target1,4-Dihydroxy-2-naphthoyl-CoA synthase
LigandBDBM50329092
Substrate/Competitorn/a
Meas. Tech.ChEMBL_674193
IC50>122000±n/a nM
Citation Li, XLiu, NZhang, HKnudson, SESlayden, RATonge, PJ Synthesis and SAR studies of 1,4-benzoxazine MenB inhibitors: novel antibacterial agents against Mycobacterium tuberculosis. Bioorg Med Chem Lett20:6306-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
1,4-Dihydroxy-2-naphthoyl-CoA synthase
Name:1,4-Dihydroxy-2-naphthoyl-CoA synthase
Synonyms:DHNA-CoA synthase
Type:PROTEIN
Mol. Mass.:34688.06
Organism:Mycobacterium tuberculosis
Description:ChEMBL_817596
Residue:314
Sequence:
MVAPAGEQGRSSTALSDNPFDAKAWRLVDGFDDLTDITYHRHVDDATVRVAFNRPEVRNA
FRPHTVDELYRVLDHARMSPDVGVVLLTGNGPSPKDGGWAFCSGGDQRIRGRSGYQYASG
DTADTVDVARAGRLHILEVQRLIRFMPKVVICLVNGWAAGGGHSLHVVCDLTLASREYAR
FKQTDADVGSFDGGYGSAYLARQVGQKFAREIFFLGRTYTAEQMHQMGAVNAVAEHAELE
TVGLQWAAEINAKSPQAQRMLKFAFNLLDDGLVGQQLFAGEATRLAYMTDEAVEGRDAFL
QKRPPDWSPFPRYF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50329092
NameBDBM50329092
Synonyms:(Z)-methyl 2-(3-oxo-3,4-dihydroquinoxalin-2(1H)-ylidene)acetate | CHEMBL1269433
TypeSmall organic molecule
Emp. Form.C11H10N2O3
Mol. Mass.218.2087
SMILESCOC(=O)Cc1nc2ccccc2[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a