Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEukaryotic elongation factor 2 kinase
LigandBDBM50329427
Substrate/Competitorn/a
Meas. Tech.ChEMBL_673934
IC50>1±n/a nM
Citation Menichincheri, MAlbanese, CAlli, CBallinari, DBargiotti, ACaldarelli, MCiavolella, ACirla, AColombo, MColotta, FCroci, VD'Alessio, RD'Anello, MErmoli, AFiorentini, FForte, BGalvani, AGiordano, PIsacchi, AMartina, KMolinari, AMoll, JKMontagnoli, AOrsini, POrzi, FPesenti, EPillan, ARoletto, FScolaro, ATatò, MTibolla, MValsasina, BVarasi, MVianello, PVolpi, DSantocanale, CVanotti, E Cdc7 kinase inhibitors: 5-heteroaryl-3-carboxamido-2-aryl pyrroles as potential antitumor agents. 1. Lead finding. J Med Chem53:7296-315 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Eukaryotic elongation factor 2 kinase
Name:Eukaryotic elongation factor 2 kinase
Synonyms:Calcium/calmodulin-dependent eukaryotic elongation factor 2 kinase | EEF2K | Eukaryotic elongation factor 2 kinase (EEF2K) | Eukaryotic elongation factor 2 kinase (eEF-2K) | eEF-2 kinase | eEF-2K
Type:Protein
Mol. Mass.:82116.99
Organism:Homo sapiens (Human)
Description:n/a
Residue:725
Sequence:
MADEDLIFRLEGVDGGQSPRAGHDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYY
SNLTKSERYSSSGSPANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRYNAV
TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL
GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
QVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN
MASRDHDHLDNHRESENSGDSGYPSEKRGELDDPEPREHGHSYSNRKYESDEDSLGSSGR
VCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMVRYHEGGRFC
EKGEEWDQESAVFHLEHAANLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDY
LLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQ
DEPRYMMLAREAEMLFTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW
AQMEE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50329427
NameBDBM50329427
Synonyms:5-(2-Amino-pyrimidin-4-yl)-2-phenyl-1H-pyrrole-3-carboxamide | CHEMBL1270230 | US9670191, U1
TypeSmall organic molecule
Emp. Form.C15H13N5O
Mol. Mass.279.2966
SMILESNC(=O)c1cc([nH]c1-c1ccccc1)-c1ccnc(N)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a