Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 3A
LigandBDBM85330
Substrate/Competitorn/a
Meas. Tech.ChEMBL_674333
Ki 3.4±n/a nM
Citation Yang, ZFairfax, DJMaeng, JHMasih, LUsyatinsky, AHassler, CIsaacson, SFitzpatrick, KDeOrazio, RJChen, JHarding, JPIsherwood, MDobritsa, SChristensen, KLWierschke, JDBliss, BIPeterson, LHBeer, CMCioffi, CLynch, MRennells, WMRichards, JJRust, TKhmelnitsky, YLCohen, MLManning, DD Discovery of 2-substituted benzoxazole carboxamides as 5-HT3 receptor antagonists. Bioorg Med Chem Lett20:6538-41 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 3A
Name:5-hydroxytryptamine receptor 3A/3C
Synonyms:5-HT-3 | 5-HT3 | 5-HT3A | 5-HT3R | 5-hydroxytryptamine receptor 3 (5-HT3) | 5-hydroxytryptamine receptor 3A (5-HT3a) | 5-hydroxytryptamine receptor 3A (5HT3A) | HTR3A | Serotonin 3 (5-HT3) receptor | Serotonin 3 receptor (5HT3) | Serotonin receptor 3A | Serotonin-gated ion channel receptor | Serotonin-gated ion channel receptor 3
Type:Protein
Mol. Mass.:55283.27
Organism:Homo sapiens (Human)
Description:P46098
Residue:478
Sequence:
MLLWVQQALLALLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTT
VSIDVIVYAILNVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKLSIPTDSIWVPDI
LINEFVDVGKSPNIPYVYIRHQGEVQNYKPLQVVTACSLDIYNFPFDVQNCSLTFTSWLH
TIQDINISLWRLPEKVKSDRSVFMNQGEWELLGVLPYFREFSMESSNYYAEMKFYVVIRR
RPLFYVVSLLLPSIFLMVMDIVGFYLPPNSGERVSFKITLLLGYSVFLIIVSDTLPATAI
GTPLIGVYFVVCMALLVISLAETIFIVRLVHKQDLQQPVPAWLRHLVLERIAWLLCLREQ
STSQRPPATSQATKTDDCSAMGNHCSHMGGPQDFEKSPRDRCSPPPPPREASLAVCGLLQ
ELSSIRQFLEKRDEIREVARDWLRVGSVLDKLLFHIYLLAVLAYSITLVMLWSIWQYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85330
NameBDBM85330
Synonyms:CAS_68647 | NSC_68647 | ONDANSETRON | Ondansetron hydrochloride
TypeSmall organic molecule
Emp. Form.C18H19N3O
Mol. Mass.293.363
SMILESCc1nccn1CC1CCc2c(C1=O)c1ccccc1n2C
Structure
n/a