Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFructose-bisphosphate aldolase A
LigandBDBM50330436
Substrate/Competitorn/a
Meas. Tech.ChEMBL_684839
Ki 2500000±n/a nM
Citation Daher, RCoinçon, MFonvielle, MGest, PMGuerin, MEJackson, MSygusch, JTherisod, M Rational design, synthesis, and evaluation of new selective inhibitors of microbial class II (zinc dependent) fructose bis-phosphate aldolases. J Med Chem53:7836-42 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fructose-bisphosphate aldolase A
Name:Fructose-bisphosphate aldolase A
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:39351.00
Organism:Oryctolagus cuniculus
Description:ChEMBL_813854
Residue:364
Sequence:
MPHSHPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYR
QLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTN
GETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHAC
TQKYSHEEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTF
SYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFIS
NHAY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50330436
NameBDBM50330436
Synonyms:2-(hydroxy(3-hydroxypropyl)amino)-2-oxoethyl hydrogen phosphate | CHEMBL1276292
TypeSmall organic molecule
Emp. Form.C5H12NO7P
Mol. Mass.229.125
SMILESOCCCN(O)C(=O)COP(O)(O)=O
Structure
n/a