Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFructose-bisphosphate aldolase
LigandBDBM50330439
Substrate/Competitorn/a
Meas. Tech.ChEMBL_684841
Ki 297±n/a nM
Citation Daher, RCoinçon, MFonvielle, MGest, PMGuerin, MEJackson, MSygusch, JTherisod, M Rational design, synthesis, and evaluation of new selective inhibitors of microbial class II (zinc dependent) fructose bis-phosphate aldolases. J Med Chem53:7836-42 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fructose-bisphosphate aldolase
Name:Fructose-bisphosphate aldolase
Synonyms:37 kDa major allergen | FBP aldolase | FBPA | Fructose-1,6-bisphosphate aldolase | IgE-binding allergen
Type:PROTEIN
Mol. Mass.:39211.38
Organism:Candida albicans
Description:ChEMBL_684841
Residue:359
Sequence:
MAPPAVLSKSGVIYGKDVKDLFDYAQEKGFAIPAINVTSSSTVVAALEAARDNKAPIILQ
TSQGGAAYFAGKGVDNKDQAASIAGSIAAAHYIRAIAPTYGIPVVLHTDHCAKKLLPWFD
GMLKADEEFFAKTGTPLFSSHMLDLSEETDDENIATCAKYFERMAKMGQWLEMEIGITGG
EEDGVNNEHVEKDALYTSPETVFAVYESLHKISPNFSIAAAFGNVHGVYKPGNVQLRPEI
LGDHQVYAKKQIGTDAKHPLYLVFHGGSGSTQEEFNTAIKNGVVKVNLDTDCQYAYLTGI
RDYVTNKIEYLKAPVGNPEGADKPNKKYFDPRVWVREGEKTMSKRIAEALDIFHTKGQL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50330439
NameBDBM50330439
Synonyms:2-[hydroxy(4-hydroxybutyl)amino]-2-oxoethyl dihydrogen phosphate | CHEMBL1236227 | N-(4-hydroxybutyl)-phospho-glycolohydroxamic acid
TypeSmall organic molecule
Emp. Form.C6H14NO7P
Mol. Mass.243.1516
SMILESOCCCCN(O)C(=O)COP(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a