Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNADPH oxidase 4
LigandBDBM50330742
Substrate/Competitorn/a
Meas. Tech.ChEMBL_685143
Ki 47±n/a nM
Citation Laleu, BGaggini, FOrchard, MFioraso-Cartier, LCagnon, LHoungninou-Molango, SGradia, ADuboux, GMerlot, CHeitz, FSzyndralewiez, CPage, P First in class, potent, and orally bioavailable NADPH oxidase isoform 4 (Nox4) inhibitors for the treatment of idiopathic pulmonary fibrosis. J Med Chem53:7715-30 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
NADPH oxidase 4
Name:NADPH oxidase 4
Synonyms:KOX-1 | Kidney oxidase-1 | Kidney superoxide-producing NADPH oxidase | NOX4 | RENOX | Renal NAD(P)H-oxidase
Type:PROTEIN
Mol. Mass.:66954.54
Organism:Homo sapiens (Human)
Description:ChEMBL_792879
Residue:578
Sequence:
MAVSWRSWLANEGVKHLCLFIWLSMNVLLFWKTFLLYNQGPEYHYLHQMLGLGLCLSRAS
ASVLNLNCSLILLPMCRTLLAYLRGSQKVPSRRTRRLLDKSRTFHITCGVTICIFSGVHV
AAHLVNALNFSVNYSEDFVELNAARYRDEDPRKLLFTTVPGLTGVCMVVVLFLMITASTY
AIRVSNYDIFWYTHNLFFVFYMLLTLHVSGGLLKYQTNLDTHPPGCISLNRTSSQNISLP
EYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLY
RYIRSNKPVTIISVMSHPSDVMEIRMVKENFKARPGQYITLHCPSVSALENHPFTLTMCP
TETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEES
LNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLH
NKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGK
TVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50330742
NameBDBM50330742
Synonyms:2-(2-Chlorophenyl)-5-[(1-methyl-1H-pyrazol-3-yl)methyl]-4-{[methyl(pyridin-3-ylmethyl)amino]methyl}-1H-pyrazolo[4,3-c]-pyridine-3,6(2H,5H)-dione | CHEMBL1277852
TypeSmall organic molecule
Emp. Form.C26H25ClN6O2
Mol. Mass.488.969
SMILESCN(Cc1ccccc1)Cc1n(Cc2ccn(C)n2)c(=O)cc2[nH]n(-c3ccccc3Cl)c(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a