Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNADPH oxidase 1
LigandBDBM50330722
Substrate/Competitorn/a
Meas. Tech.ChEMBL_685172
Ki 165±n/a nM
Citation Laleu, BGaggini, FOrchard, MFioraso-Cartier, LCagnon, LHoungninou-Molango, SGradia, ADuboux, GMerlot, CHeitz, FSzyndralewiez, CPage, P First in class, potent, and orally bioavailable NADPH oxidase isoform 4 (Nox4) inhibitors for the treatment of idiopathic pulmonary fibrosis. J Med Chem53:7715-30 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
NADPH oxidase 1
Name:NADPH oxidase 1
Synonyms:MOX-1 | MOX1 | Mitogenic oxidase 1 | NADH/NADPH mitogenic oxidase subunit P65-MOX | NOH-1 | NOH1 | NOX-1 | NOX1
Type:PROTEIN
Mol. Mass.:64890.44
Organism:Homo sapiens (Human)
Description:ChEMBL_792877
Residue:564
Sequence:
MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCL
NFNSTLILLPVCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHL
FNFDCYSRSRQATDGSLASILSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVI
MTIALILMVTSATEFIRRSYFEVFWYTHHLFIFYILGLGIHGIGGIVRGQTEESMNESHP
RKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILYICERILRFYRSQQKVVITKV
VMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDFFSIHIRAAGD
WTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYK
FQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSN
IVGHAALNFDKATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSL
RKCCHRYSSLDPRKVQFYFNKENF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50330722
NameBDBM50330722
Synonyms:2-(2-chlorophenyl)-4-methyl-5-(pyridin-2-ylmethyl)-1H-pyrazolo[4,3-c]pyridine-3,6(2H,5H)-dione | CHEMBL1276946
TypeSmall organic molecule
Emp. Form.C19H15ClN4O2
Mol. Mass.366.801
SMILESCc1n(Cc2ccccn2)c(=O)cc2[nH]n(-c3ccccc3Cl)c(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a