Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEstradiol 17-beta-dehydrogenase 1 (17beta-HSD1)
LigandBDBM50330999
Substrate/Competitorn/a
Meas. Tech.ChEMBL_684635
IC50 8±n/a nM
Citation Oster, AHinsberger, SWerth, RMarchais-Oberwinkler, SFrotscher, MHartmann, RW Bicyclic substituted hydroxyphenylmethanones as novel inhibitors of 17ß-hydroxysteroid dehydrogenase type 1 (17ß-HSD1) for the treatment of estrogen-dependent diseases. J Med Chem53:8176-86 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Estradiol 17-beta-dehydrogenase 1 (17beta-HSD1)
Name:Estradiol 17-beta-dehydrogenase 1
Synonyms:17-beta-HSD 1 | 17-beta-hydroxysteroid dehydrogenase type 1 | 20 alpha-hydroxysteroid dehydrogenase | 20-alpha-HSD | E2DH | Estradiol 17-beta-dehydrogenase 1 | Placental 17-beta-hydroxysteroid dehydrogenase
Type:Enzyme
Mol. Mass.:34945.13
Organism:Homo sapiens (Human)
Description:P14061
Residue:328
Sequence:
MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAARALACPPGSL
ETLQLDVRDSKSVAAARERVTEGRVDVLVCNAGLGLLGPLEALGEDAVASVLDVNVVGTV
RMLQAFLPDMKRRGSGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVH
LSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFYQYLAHSKQVFREAAQNPEEVAEV
FLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNYVTAMHREVFGDVPAKAEAGAEAGG
GAGPGAEDEAGRGAVGDPELGDPPAAPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50330999
NameBDBM50330999
Synonyms:CHEMBL1277708 | [5-(4-Hydroxy-3-methylphenyl)-2-thienyl](3-hydroxyphenyl)-methanone
TypeSmall organic molecule
Emp. Form.C18H14O3S
Mol. Mass.310.367
SMILESCc1cc(ccc1O)-c1ccc(s1)C(=O)c1cccc(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a