Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium/glucose cotransporter 2 (SGLT2)
LigandBDBM20880
Substrate/Competitorn/a
Meas. Tech.ChEMBL_686506
IC50 0.49±n/a nM
Citation Lee, JKim, JYChoi, JLee, SHKim, JLee, J Pyrimidinylmethylphenyl glucoside as novel C-aryl glucoside SGLT2 inhibitors. Bioorg Med Chem Lett20:7046-9 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sodium/glucose cotransporter 2 (SGLT2)
Name:Sodium/glucose cotransporter 2 (SGLT2)
Synonyms:Na(+)/glucose cotransporter 2 | Sodium-Dependent Glucose Cotransporter 2 (SGLT2) | Sodium-dependent glucose cotransporter 2 (SGLT2) | Sodium/glucose cotransporter 1 (SGLT1) | Sodium/glucose cotransporter 2 | Solute carrier family 5 member 2
Type:Protein
Mol. Mass.:72902.00
Organism:Homo sapiens (Human)
Description:P31639
Residue:672
Sequence:
MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGR
SMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTA
GVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIA
LLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSL
TVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR
CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVG
CSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR
ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRV
NEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLL
TLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ
APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLM
MAVAVFLWGFYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM20880
NameBDBM20880
Synonyms:(2S,3R,4R,5S,6R)-2-{4-chloro-3-[(4-ethoxyphenyl)methyl]phenyl}-6-(hydroxymethyl)oxane-3,4,5-triol | BMS-512148 | C-aryl glucoside, 6 | CHEMBL429910 | Dapagliflozin
TypeSmall organic molecule
Emp. Form.C21H25ClO6
Mol. Mass.408.873
SMILESCCOc1ccc(Cc2cc(ccc2Cl)[C@@H]2O[C@H](CO)[C@@H](O)[C@H](O)[C@H]2O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a