Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMyeloperoxidase (MPO)
LigandBDBM50332575
Substrate/Competitorn/a
Meas. Tech.ChEMBL_695894
IC50 850±n/a nM
Citation Soubhye, JPrévost, MVan Antwerpen, PZouaoui Boudjeltia, KRousseau, AFurtmüller, PGObinger, CVanhaeverbeek, MDucobu, JNéve, JGelbcke, MDufrasne, FO Structure-based design, synthesis, and pharmacological evaluation of 3-(aminoalkyl)-5-fluoroindoles as myeloperoxidase inhibitors. J Med Chem53:8747-59 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Myeloperoxidase (MPO)
Name:Myeloperoxidase
Synonyms:84 kDa myeloperoxidase | 89 kDa myeloperoxidase | MPO | Mpo protein | Myeloperoxidase | Myeloperoxidase heavy chain | Myeloperoxidase light chain
Type:Enzyme
Mol. Mass.:83888.32
Organism:Homo sapiens (Human)
Description:P05164
Residue:745
Sequence:
MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTS
LVLSSMEEAKQLVDKAYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLH
VALDLLERKLRSLWRRPFNVTDVLTPAQLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMC
NNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTD
QLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPND
PRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQL
GLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLL
REHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYR
SYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLE
GGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYN
AWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPL
LACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMS
NSYPRDFVNCSTLPALNLASWREAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50332575
NameBDBM50332575
Synonyms:CHEMBL1630726 | N-ethyl-2-(5-fluoro-1H-indol-3-yl)ethanamine
TypeSmall organic molecule
Emp. Form.C12H15FN2
Mol. Mass.206.2593
SMILESCCNCCc1c[nH]c2ccc(F)cc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a