Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-7 (MMP7)
LigandBDBM50332948
Substrate/Competitorn/a
Meas. Tech.ChEMBL_694545
Ki 344±n/a nM
Citation Attolino, ECalderone, VDragoni, EFragai, MRichichi, BLuchinat, CNativi, C Structure-based approach to nanomolar, water soluble matrix metalloproteinases inhibitors (MMPIs). Eur J Med Chem45:5919-25 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-7 (MMP7)
Name:Matrix metalloproteinase 7
Synonyms:Matrix metalloproteinase 7 | Matrix metalloproteinase-7 (MMP-7)
Type:Enzyme
Mol. Mass.:29681.54
Organism:Homo sapiens (Human)
Description:P09237
Residue:267
Sequence:
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50332948
NameBDBM50332948
Synonyms:(R)-2-(N-((S)-2,3-dihydroxypropyl)-4-methoxyphenylsulfonamido)-N,3-dihydroxypropanamide | CHEMBL1632638
TypeSmall organic molecule
Emp. Form.C13H20N2O8S
Mol. Mass.364.371
SMILESCOc1ccc(cc1)S(=O)(=O)N(C[C@H](O)CO)[C@H](CO)C(=O)NO |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a