Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 6 (CA-VI)
LigandBDBM26980
Substrate/Competitorn/a
Meas. Tech.ChEMBL_700657
Ki 730000±n/a nM
Citation Bertucci, AInnocenti, AScozzafava, ATambutté, SZoccola, DSupuran, CT Carbonic anhydrase inhibitors. Inhibition studies with anions and sulfonamides of a new cytosolic enzyme from the scleractinian coral Stylophora pistillata. Bioorg Med Chem Lett21:710-4 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 6 (CA-VI)
Name:Carbonic anhydrase 6 (CA-VI)
Synonyms:CA-VI | Carbonate dehydratase VI | Carbonic Anhydrase VI | Carbonic anhydrase 6 | Carbonic anhydrase 6 (CA VI) | Carbonic anhydrase VI (CA VI) | Salivary carbonic anhydrase | Secreted carbonic anhydrase
Type:Enzyme
Mol. Mass.:35371.40
Organism:Homo sapiens (Human)
Description:P23280
Residue:308
Sequence:
MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYN
PSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSE
ISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNF
ISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLS
RTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEIL
DYLRRALN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26980
NameBDBM26980
Synonyms:BROMIDE | Br- | CHEMBL11685 | CHEMBL1644030 | CHEMBL1644694 | bromide | bromide ion
TypeIon
Emp. Form.Br
Mol. Mass.79.905
SMILES[Br-]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a