Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha carbonic anhydrase
LigandBDBM10882
Substrate/Competitorn/a
Meas. Tech.ChEMBL_700658
Ki 39.4±n/a nM
Citation Bertucci, AInnocenti, AScozzafava, ATambutté, SZoccola, DSupuran, CT Carbonic anhydrase inhibitors. Inhibition studies with anions and sulfonamides of a new cytosolic enzyme from the scleractinian coral Stylophora pistillata. Bioorg Med Chem Lett21:710-4 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha carbonic anhydrase
Name:Alpha carbonic anhydrase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:36650.57
Organism:Stylophora pistillata
Description:ChEMBL_700658
Residue:323
Sequence:
MKLSLFISSLLAMIVACPNLAESAGSWTYRDPEGPDTWKHHYKDCEGHEQSPINIVPKDT
FFEPGLADLVVNYEKSVSAKLFNNGHTVQATFLTGKSNISGGNLTSHFRALQMHFHWGSE
NSRGSEHQVGGRKFPLEIHIVHYNAEKYPSVSEAVDKGDGLAVLGILVELQVQDNPVFDV
MVDNLDKARYKGNEVILPSLQPFSFLPHDIAQYYTYRGSLTTPGCFESVQWFVFNHTFPI
SQAQLDKFRDLFDSEKQDTKKLPLVDNYRPVQPLYGRSVSEASNALLFPVARHQTKLWIA
WDSLMTRQYFMKQQSICALYQPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10882
NameBDBM10882
Synonyms:6-ethoxy-1,3-benzothiazole-2-sulfonamide | CHEMBL18 | Ethamide | Ethoxazolamide | Ethoxzolamide | Ethoxzolamide (EZA) | Ethoxzolamide, EZM | Sulfonamide, 3 | US10172837, Ethoxyzolamide | sulfonamide 3
TypeSmall organic molecule
Emp. Form.C9H10N2O3S2
Mol. Mass.258.317
SMILESCCOc1ccc2nc(sc2c1)S(N)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a