Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha carbonic anhydrase
LigandBDBM26999
Substrate/Competitorn/a
Meas. Tech.ChEMBL_700658
Ki 45.2±n/a nM
Citation Bertucci, AInnocenti, AScozzafava, ATambutté, SZoccola, DSupuran, CT Carbonic anhydrase inhibitors. Inhibition studies with anions and sulfonamides of a new cytosolic enzyme from the scleractinian coral Stylophora pistillata. Bioorg Med Chem Lett21:710-4 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alpha carbonic anhydrase
Name:Alpha carbonic anhydrase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:36650.57
Organism:Stylophora pistillata
Description:ChEMBL_700658
Residue:323
Sequence:
MKLSLFISSLLAMIVACPNLAESAGSWTYRDPEGPDTWKHHYKDCEGHEQSPINIVPKDT
FFEPGLADLVVNYEKSVSAKLFNNGHTVQATFLTGKSNISGGNLTSHFRALQMHFHWGSE
NSRGSEHQVGGRKFPLEIHIVHYNAEKYPSVSEAVDKGDGLAVLGILVELQVQDNPVFDV
MVDNLDKARYKGNEVILPSLQPFSFLPHDIAQYYTYRGSLTTPGCFESVQWFVFNHTFPI
SQAQLDKFRDLFDSEKQDTKKLPLVDNYRPVQPLYGRSVSEASNALLFPVARHQTKLWIA
WDSLMTRQYFMKQQSICALYQPQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26999
NameBDBM26999
Synonyms:4-(1,1-dioxo-1,2-thiazinan-2-yl)benzene-1-sulfonamide | CHEMBL328560 | Contravul | Ospolot | Sulthiame (SLT) | Sulthiame, 2
TypeSmall organic molecule
Emp. Form.C10H14N2O4S2
Mol. Mass.290.359
SMILESNS(=O)(=O)c1ccc(cc1)N1CCCCS1(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a