Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetADC-16 protein
LigandBDBM50021959
Substrate/Competitorn/a
Meas. Tech.ChEMBL_703758
IC50 1462480±n/a nM
Citation Beceiro, APérez, AFernández-Cuenca, FMartínez-Martínez, LPascual, AVila, JRodríguez-Baño, JCisneros, JMPachón, JBou, G Genetic variability among ampC genes from acinetobacter genomic species 3. Antimicrob Agents Chemother53:1177-84 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ADC-16 protein
Name:ADC-16 protein
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:43150.78
Organism:Acinetobacter genomosp. 3
Description:ChEMBL_703758
Residue:383
Sequence:
MRFKKISCLLLPPLFIFSSSIYAGNTPKEQEIKKLVDQNFKPLLEKYDVPGMAVGVIQNN
KKYEMYYGLQSVQDKKAVNSNTIFELGSVSKLFTATAGGYAKTKGTISFNDTPGKYWKEL
KNTPIDQVNLLQLATYTSGNLALQFPDEVKTDQQVLTFFKEWKPKNPIGEYRQYSNPSIG
LFGKVVALSMNKPFDQVLEKTIFPDLGLKHSYVNVPKTQMQNYAFGYNQENQPIRVNPGP
LDAPAYGVKSTLPDMLSFINANLNPQKYPANIQRAINETHQGFYQVGTMYQALGWEEFSY
PALLQTLLDSNSEQIVMKPNKVTAISKEPSVKMFHKTGSTNGFGTYVVFIPKENIGLVML
TNKRIPNEERIKAAYAVLNAIKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50021959
NameBDBM50021959
Synonyms:CHEMBL777 | MM 14151 | US9120808, Clavulanic acid potassium salt | antibiotic MM 14151 | clavulanic acid
TypeSmall organic molecule
Emp. Form.C8H9NO5
Mol. Mass.199.1608
SMILESOC\C=C1/O[C@@H]2CC(=O)N2[C@H]1C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a