Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor subunit beta-2
LigandBDBM50336020
Substrate/Competitorn/a
Meas. Tech.ChEMBL_717231
Ki 39000±n/a nM
Citation Lin, SWSun, QGe, ZMWang, XYe, JLi, RT Synthesis and structure-analgesic activity relationships of a novel series of monospirocyclopiperazinium salts (MSPZ). Bioorg Med Chem Lett21:940-3 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuronal acetylcholine receptor subunit beta-2
Name:Neuronal acetylcholine receptor subunit beta-2
Synonyms:Neuronal acetylcholine receptor protein beta-2 subunit | Nicotinic acetylcholine receptor alpha3/beta2/alpha5
Type:Protein
Mol. Mass.:57020.50
Organism:Homo sapiens (Human)
Description:P17787
Residue:502
Sequence:
MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQL
MVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLY
NNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDR
TEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTIN
LIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKY
LMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQR
LRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPC
GCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ
PLFQNYTTTTFLHSDHSAPSSK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50336020
NameBDBM50336020
Synonyms:CHEMBL1669092 | N,N,N-trimethyl-1-(4-styrylphenoxy)propan-2-aminium iodide
TypeSmall organic molecule
Emp. Form.C20H26NO
Mol. Mass.296.426
SMILESCC(COc1ccc(\C=C/c2ccccc2)cc1)[N+](C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a