Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetmineralocorticoid
LigandBDBM50336281
Substrate/Competitorn/a
Meas. Tech.ChEMBL_716553
IC50 16550±n/a nM
Citation Jiang, CSZhou, RGong, JXChen, LLKurtán, TShen, XGuo, YW Synthesis, modification, and evaluation of (R)-de-O-methyllasiodiplodin and analogs as nonsteroidal antagonists of mineralocorticoid receptor. Bioorg Med Chem Lett21:1171-5 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
mineralocorticoid
Name:mineralocorticoid
Synonyms:MR | Mineralocorticoid Receptor (MR) | Mineralocorticoid receptor | Nuclear receptor subfamily 3 group C member 2
Type:Enzyme Catalytic Domain
Mol. Mass.:106748.15
Organism:RAT
Description:mineralocorticoid 0 RAT::P22199
Residue:981
Sequence:
METKGYHSLPEGLDMERRWSQVSQTLERSSLGPAERTTENNYMEIVNVSCVSGAIPNNST
QGSSKEKHELLPYIQQDNSRSGILPSDIKTELESKELSATVAESMGLYMDSVRDAEYTYD
QQNQQGSLSPTKIYQNMEQLVKFYKENGHRSSTLSAMSRPLRSFMPDSAASMNGGALRAI
VKSPIICHEKSSSVSSPLNMASSVCSPVGINSMSSSTTSFGSFPVHSPITQGTSLTCSPS
VENRGSRSHSPTHASNVGSPLSSPLSSMKSPISSPPSHCSVKSPVSSPNNVPLRSSVSSP
ANLNNSRCSVSSPSNNTNNRSTLSSPTASTVGSIGSPISNAFSYATSGASAGAGAIQDVV
PSPDTHEKGAHDVPFPKTEEVEKAISNGVTGPLNIVQYIKSEPDGAFSSSCLGGNSKISP
SSPFSVPIKQESSKHSCSGASFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPG
FDGSCEDSAFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSP
RDQSFQHLSSFPPVNTLVESWKPHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRP
SKICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACR
LQKCLQAGMNLGARKSKKLGKLKGLHEEQPQQPPPPPPQSPEEGTTYIAPTKEPSVNSAL
VPQLTSITHALTPSPAMILENIEPETVYAGYDNSKPDTAESLLSTLNRLAAKQMIQVVKW
AKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQLLYFAPDLVFNEEKMHQS
AMYELCQGMRQISLQFVRLQLTFEEYSIMKVLLLLSTVPKDGLKSQAAFEEMRTNYIKEL
RKMVTKCPNSSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESQALKVEFPAMLVEI
ITDQLPKVESGNAKPLYFHRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50336281
NameBDBM50336281
Synonyms:(R,Z)-12,14-dimethoxy-3-methyl-3,4,5,6,9,10-hexahydro-1H-benzo[c][1]oxacyclododecin-1-one | CHEMBL1669746
TypeSmall organic molecule
Emp. Form.C18H24O4
Mol. Mass.304.3808
SMILESCOc1cc2CC\C=C/CCC[C@@H](C)OC(=O)c2c(OC)c1 |r,c:7|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a