Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine A2b receptor
LigandBDBM50336977
Substrate/Competitorn/a
Meas. Tech.ChEMBL_718298
IC50 512±n/a nM
Citation Eastwood, PEsteve, CGonzález, JFonquerna, SAiguadé, JCarranco, IsDoménech, TAparici, MsMiralpeix, MAlbertí, JCórdoba, MFernández, RPont, MsGodessart, NsPrats, NLoza, MsCadavid, MsNueda, A Discovery of LAS101057: A Potent, Selective, and Orally Efficacious A2B Adenosine Receptor Antagonist ACS Med Chem Lett2:213-218 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine A2b receptor
Name:Adenosine A2b receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:36130.09
Organism:Mus musculus
Description:ChEMBL_11831
Residue:332
Sequence:
MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFA
IPFAITISLGFCTDFHGCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGT
RARGIIAVLWVLAFGIGLTPFLGWNSKDSATSNCTELGDGIANKSCCPVTCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFMVACKQLQRMELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYS
FHKIISRYVLCQAETKGGSGQAGAQSTLSLGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50336977
NameBDBM50336977
Synonyms:CHEMBL1672627 | N-[5-(3-Fluoropyridin-4-yl)-6-pyridin-3-ylpyrazin-2-yl]cyclopropanecarboxamide
TypeSmall organic molecule
Emp. Form.C18H14FN5O
Mol. Mass.335.3351
SMILESFc1cnccc1-c1ncc(NC(=O)C2CC2)nc1-c1cccnc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a