BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAromatase (CYP19)
LigandBDBM50337120
Substrate/Competitorn/a
Meas. Tech.ChEMBL_718780
IC50 0.15±n/a nM
Citation Woo, LWBubert, CPurohit, A Hybrid Dual Aromatase-Steroid Sulfatase Inhibitors with Exquisite Picomolar Inhibitory Activity ACS Med Chem Lett2:243-247 (2011)    Article
More Info.:Get all data from this article,  Assay Method
 
Aromatase (CYP19)
Name:Aromatase (CYP19)
Synonyms:Aromatase | CYPXIX | Cytochrome P-450AROM | Cytochrome P450 19A1 | Cytochrome P450 2C19 | Cytochrome P450-C19 (CYP19) | Estrogen synthetase | FL cytokine receptor precursor | P-450AROM | Tyrosine Kinase FLT3
Type:Enzyme
Mol. Mass.:57888.92
Organism:Homo sapiens (human)
Description:P11511
Residue:503
Sequence:
MVLEMLNPIHYNITSIVPEAMPAATMPVLLLTGLFLLVWNYEGTSSIPGPGYCMGIGPLI
SHGRFLWMGIGSACNYYNRVYGEFMRVWISGEETLIISKSSSMFHIMKHNHYSSRFGSKL
GLQCIGMHEKGIIFNNNPELWKTTRPFFMKALSGPGLVRMVTVCAESLKTHLDRLEEVTN
ESGYVDVLTLLRRVMLDTSNTLFLRIPLDESAIVVKIQGYFDAWQALLIKPDIFFKISWL
YKKYEKSVKDLKDAIEVLIAEKRRRISTEEKLEECMDFATELILAEKRGDLTRENVNQCI
LEMLIAAPDTMSVSLFFMLFLIAKHPNVEEAIIKEIQTVIGERDIKIDDIQKLKVMENFI
YESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRGCAGKYIAMVMMKAILVTLLRRFHVKTLQGQCVESIQKIHDLSLH
PDETKNMLEMIFTPRNSDRCLEH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50337120
NameBDBM50337120
Synonyms:4-(((6-cyanobiphenyl-3-yl)(4H-1,2,4-triazol-4-yl)amino)methyl)-2-fluorophenyl sulfamate | CHEMBL1672977
TypeSmall organic molecule
Emp. Form.C22H17FN6O3S
Mol. Mass.464.472
SMILESNS(=O)(=O)Oc1ccc(CN(c2ccc(C#N)c(c2)-c2ccccc2)n2cnnc2)cc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a