Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldo-keto reductase family 1 member C2
LigandBDBM50337283
Substrate/Competitorn/a
Meas. Tech.ChEMBL_726381
IC50 15000±n/a nM
Citation Adeniji, AOTwenter, BMByrns, MCJin, YWinkler, JDPenning, TM Discovery of substituted 3-(phenylamino)benzoic acids as potent and selective inhibitors of type 5 17ß-hydroxysteroid dehydrogenase (AKR1C3). Bioorg Med Chem Lett21:1464-8 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldo-keto reductase family 1 member C2
Name:Aldo-keto reductase family 1 member C2
Synonyms:3-alpha-HSD3 | 3-alpha-Hydroxysteroid Dehydrogenase Type 3 (AKR1C2) | Aldo-keto reductase family 1 member C2 (AK1C2) | Aldo-keto reductase family 1 member C2 (AK1C2a) | Aldo-keto reductase family 1 member C2 (AKR1C2) | Chlordecone reductase homolog HAKRD | DD-2 | DD/BABP | Dihydrodiol dehydrogenase 2 | Dihydrodiol dehydrogenase/bile acid-binding protein | Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase | Type III 3-alpha-hydroxysteroid dehydrogenase
Type:Enzyme
Mol. Mass.:36739.89
Organism:Homo sapiens (human)
Description:n/a
Residue:323
Sequence:
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
SVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKP
GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN
RNVRYLTLDIFAGPPNYPFSDEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50337283
NameBDBM50337283
Synonyms:3-[N-(4-trifluoromethylphenyl)amino]benzoic acid | CHEMBL1682202 | US9271961, 7
TypeSmall organic molecule
Emp. Form.C14H10F3NO2
Mol. Mass.281.2299
SMILESOC(=O)c1cccc(Nc2ccc(cc2)C(F)(F)F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a