Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic anhydrase 1
LigandBDBM26980
Substrate/Competitorn/a
Meas. Tech.ChEMBL_735670
pH7.5±n/a
Ki 4000000±n/a nM
Commentsextracted
Citation Cincinelli, AMartellini, TInnocenti, AScozzafava, ASupuran, CT Purification and inhibition studies with anions and sulfonamides of ana-carbonic anhydrase from the Antarctic seal Leptonychotes weddellii. Bioorg Med Chem19:1847-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carbonic anhydrase 1
Name:Carbonic anhydrase
Synonyms:CA-I | CAB | Carbonate dehydratase I | Carbonic anhydrase 1 (CA I) | Carbonic anhydrase 1 (CA-I) | Carbonic anhydrase 1 (Recombinant CA I) | Carbonic anhydrase 2 (CA II) | Carbonic anhydrase B | Carbonic anhydrase I (CA I) | Carbonic anhydrase I (CA-I) | Carbonic anhydrase I (CAI) | Carbonic anhydrase I (hCA I) | Carbonic anhydrase isoenzyme I (hCA I) | hCA
Type:Enzyme
Mol. Mass.:28873.37
Organism:Homo sapiens (Human)
Description:P00915
Residue:261
Sequence:
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26980
NameBDBM26980
Synonyms:BROMIDE | Br- | CHEMBL11685 | CHEMBL1644030 | CHEMBL1644694 | bromide | bromide ion
TypeIon
Emp. Form.Br
Mol. Mass.79.905
SMILES[Br-]
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a