Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target11-beta-hydroxysteroid dehydrogenase 2
LigandBDBM50340432
Substrate/Competitorn/a
Meas. Tech.ChEMBL_741136
IC50>10±n/a nM
Citation Venier, OPascal, CBraun, ANamane, CMougenot, PCrespin, OPacquet, FMougenot, CMonseau, COnofri, BDadji-Faïhun, RLeger, CBen-Hassine, MVan-Pham, TRagot, JLPhilippo, CGüssregen, SEngel, CFarjot, GNoah, LManiani, KNicolaï, E Pyrrolidine-pyrazole ureas as potent and selective inhibitors of 11β-hydroxysteroid-dehydrogenase type 1. Bioorg Med Chem Lett21:2244-51 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
11-beta-hydroxysteroid dehydrogenase 2
Name:11-beta-hydroxysteroid dehydrogenase 2
Synonyms:11-DH2 | 11-beta-HSD2 | 11-beta-Hydroxysteroid Dehydrogenase 2 (11-beta-HSD2) | 11-beta-hydroxysteroid dehydrogenase type 2 | 11-beta-hydroxysteroid dehydrogenase type 2 (11-beta-HSD2) | Corticosteroid 11-beta-dehydrogenase isozyme 2 | NAD-dependent 11-beta-hydroxysteroid dehydrogenase
Type:Enzyme
Mol. Mass.:44141.72
Organism:Homo sapiens (Human)
Description:Purified recombinant human 11beta-HSD2.
Residue:405
Sequence:
MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAV
LAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPG
AIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELS
PVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVA
LLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYI
EHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRR
RFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50340432
NameBDBM50340432
Synonyms:(4-(1H-imidazol-4-yl)piperidin-1-yl)(3-methyl-2H-benzo[b][1,4]oxazin-4(3H)-yl)methanone | CHEMBL1761843
TypeSmall organic molecule
Emp. Form.C18H22N4O2
Mol. Mass.326.3929
SMILESCC1COc2ccccc2N1C(=O)N1CCC(CC1)c1cnc[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a