Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAmine oxidase [flavin-containing] B
LigandBDBM50341153
Substrate/Competitorn/a
Meas. Tech.ChEMBL_740468
Ki 7.51±n/a nM
Citation Mishra, NSasmal, D Development of selective and reversible pyrazoline based MAO-B inhibitors: virtual screening, synthesis and biological evaluation. Bioorg Med Chem Lett21:1969-73 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Amine oxidase [flavin-containing] B
Name:Amine oxidase [flavin-containing] B
Synonyms:MAO-B | Monoamine oxidase type B | Monoamine oxidase type B (MAO B) | Monoamine oxidase type B (MAO B) | Monoamine oxidase type B (MAOB)
Type:Protein
Mol. Mass.:58768.76
Organism:Homo sapiens (Human)
Description:P27338
Residue:520
Sequence:
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50341153
NameBDBM50341153
Synonyms:4-(3-(anthracen-9-yl)-4,5-dihydro-1H-pyrazol-5-yl)phenol | CHEMBL1760714
TypeSmall organic molecule
Emp. Form.C23H18N2O
Mol. Mass.338.4018
SMILESOc1ccc(cc1)C1CC(N=N1)c1c2ccccc2cc2ccccc12 |c:11|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a