Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDual specificity protein phosphatase 14
LigandBDBM50342237
Substrate/Competitorn/a
Meas. Tech.ChEMBL_743532
IC50>400000±n/a nM
Citation Bahta, MLountos, GTDyas, BKim, SEUlrich, RGWaugh, DSBurke, TR Utilization of nitrophenylphosphates and oxime-based ligation for the development of nanomolar affinity inhibitors of the Yersinia pestis outer protein H (YopH) phosphatase. J Med Chem54:2933-43 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dual specificity protein phosphatase 14
Name:Dual specificity protein phosphatase 14
Synonyms:MAP kinase phosphatase 6 | MKP-1-like protein tyrosine phosphatase | MKP-6 | MKP-L | Mitogen-activated protein kinase phosphatase 6
Type:PROTEIN
Mol. Mass.:22267.79
Organism:Homo sapiens
Description:ChEMBL_743532
Residue:198
Sequence:
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNAT
IEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSAT
LCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGI
VPDVYEKESRHLMPYWGI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50342237
NameBDBM50342237
Synonyms:(E)-5-((((3'-(Difluoro(phosphono)methyl)-[1,1'-biphenyl]-4-yl)methoxy)imino)methyl)furan-2-carboxylic acid | CHEMBL1766712
TypeSmall organic molecule
Emp. Form.C20H16F2NO7P
Mol. Mass.451.3141
SMILESOC(=O)c1ccc(\C=N\OCc2ccc(cc2)-c2cccc(c2)C(F)(F)P(O)(O)=O)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a