Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLow affinity sodium-glucose cotransporter
LigandBDBM50342885
Substrate/Competitorn/a
Meas. Tech.ChEMBL_745217
IC50 0.877±n/a nM
Citation Mascitti, VMaurer, TSRobinson, RPBian, JBoustany-Kari, CMBrandt, TCollman, BMKalgutkar, ASKlenotic, MKLeininger, MTLowe, AMaguire, RJMasterson, VMMiao, ZMukaiyama, EPatel, JDPettersen, JCPréville, CSamas, BShe, LSobol, ZSteppan, CMStevens, BDThuma, BATugnait, MZeng, DZhu, T Discovery of a clinical candidate from the structurally unique dioxa-bicyclo[3.2.1]octane class of sodium-dependent glucose cotransporter 2 inhibitors. J Med Chem54:2952-60 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Low affinity sodium-glucose cotransporter
Name:Low affinity sodium-glucose cotransporter
Synonyms:Na(+)/glucose cotransporter 3 | Sodium/glucose cotransporter 3 | Solute carrier family 5 member 4
Type:PROTEIN
Mol. Mass.:72452.26
Organism:Homo sapiens (Human)
Description:ChEMBL_764617
Residue:659
Sequence:
MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKTNRGTIGGFFL
AGRDMAWWPMGASLFASNIGSNHYVGLAGTGAASGVATVTFEWTSSVMLLILGWIFVPIY
IKSGVMTMPEYLKKRFGGERLQVYLSILSLFICVVLLISADIFAGAIFIKLALGLDLYLA
IFILLAMTAVYTTTGGLASVIYTDTLQTIIMLIGSFILMGFAFNEVGGYESFTEKYVNAT
PSVVEGDNLTISASCYTPRADSFHIFRDAVTGDIPWPGIIFGMPITALWYWCTNQVIVQR
CLCGKDMSHVKAACIMCAYLKLLPMFLMVMPGMISRILYTDMVACVVPSECVKHCGVDVG
CTNYAYPTMVLELMPQGLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKMRKQASEK
ELLIAGRIFVLLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRV
NEQGAFWGLMVGLAMGLIRMITEFAYGTGSCLAPSNCPKIICGVHYLYFSIVLFFGSMLV
TLGISLLTKPIPDVHLYRLCWVLRNSTEERIDIDAEEKSQEETDDGVEEDYPEKSRGCLK
KAYDLFCGLQKGPKLTKEEEEALSKKLTDTSERPSWRTIVNINAILLLAVVVFIHGYYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50342885
NameBDBM50342885
Synonyms:(1S,2S,3S,4R,5S)-5-[4-Chloro-3-(4-ethoxybenzyl)phenyl]-1-(hydroxymethyl)-6,8-dioxa-bicyclo[3.2.1]octane-2,3,4-triol | 5-(4-chloro-3-(4-ethoxybenzyl)phenyl)-1-hydroxymethyl-6,8-dioxabicyclo(3.2.1)octane-2,3,4-triol | CHEMBL1770248 | PF-04971729 | Steglatro | ertugliflozin
TypeSmall organic molecule
Emp. Form.C22H25ClO7
Mol. Mass.436.883
SMILESCCOc1ccc(Cc2cc(ccc2Cl)[C@]23OC[C@](CO)(O2)[C@@H](O)[C@H](O)[C@H]3O)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a