Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-14 (MMP14)
LigandBDBM11885
Substrate/Competitorn/a
Meas. Tech.ChEMBL_744874
IC50 8±n/a nM
Citation Fobian, YMFreskos, JNBarta, TEBedell, LJHeintz, RKassab, DJKiefer, JRMischke, BVMolyneaux, JMMullins, PMunie, GEBecker, DP MMP-13 selective alpha-sulfone hydroxamates: identification of selective P1' amides. Bioorg Med Chem Lett21:2823-5 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-14 (MMP14)
Name:Matrix metalloproteinase 14
Synonyms:MMP-14 | MMP-X1 | MT-MMP 1 | MT1-MMP | MT1MMP | MTMMP1 | Matrix Metalloproteinase-14 (MMP-14) | Matrix metalloproteinase 14 | Matrix metalloproteinase-14 | Membrane-type matrix metalloproteinase 1 | Membrane-type-1 matrix metalloproteinase
Type:Protein
Mol. Mass.:65900.19
Organism:Homo sapiens (Human)
Description:P50281
Residue:582
Sequence:
MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQS
LSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQ
HNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIF
FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHE
LGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTT
SRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAA
AVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11885
NameBDBM11885
Synonyms:CHEMBL1082381 | N-Hydroxy-4-{[4-(phenylthio)phenyl]sulfonyl}-1-(2-propynyl)-4-piperidinecarboxamide, Monohydrochloride | N-hydroxy-4-{[4-(phenylsulfanyl)benzene]sulfonyl}-1-(prop-2-yn-1-yl)piperidine-4-carboxamide hydrochloride | SC-276 | alpha-sulfone 35f
TypeSmall organic molecule
Emp. Form.C21H22N2O4S2
Mol. Mass.430.54
SMILESONC(=O)C1(CCN(CC#C)CC1)S(=O)(=O)c1ccc(Sc2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a