Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-9
LigandBDBM11885
Substrate/Competitorn/a
Meas. Tech.ChEMBL_744871
IC50 1.5±n/a nM
Citation Fobian, YMFreskos, JNBarta, TEBedell, LJHeintz, RKassab, DJKiefer, JRMischke, BVMolyneaux, JMMullins, PMunie, GEBecker, DP MMP-13 selective alpha-sulfone hydroxamates: identification of selective P1' amides. Bioorg Med Chem Lett21:2823-5 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-9
Name:Matrix metalloproteinase-9
Synonyms:67 kDa matrix metalloproteinase-9 | 82 kDa matrix metalloproteinase-9 | 92 kDa gelatinase | 92 kDa type IV collagenase | GELB | Gelatinase B | MMP-9 | Matrix metalloproteinase 9 (MMP-9) | Matrix metalloproteinase-9 (MMP-9) | Matrix metalloproteinase-9 (MMP9)
Type:Enzyme
Mol. Mass.:78452.28
Organism:Homo sapiens (Human)
Description:P14780
Residue:707
Sequence:
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS
YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSER
PTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYW
RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11885
NameBDBM11885
Synonyms:CHEMBL1082381 | N-Hydroxy-4-{[4-(phenylthio)phenyl]sulfonyl}-1-(2-propynyl)-4-piperidinecarboxamide, Monohydrochloride | N-hydroxy-4-{[4-(phenylsulfanyl)benzene]sulfonyl}-1-(prop-2-yn-1-yl)piperidine-4-carboxamide hydrochloride | SC-276 | alpha-sulfone 35f
TypeSmall organic molecule
Emp. Form.C21H22N2O4S2
Mol. Mass.430.54
SMILESONC(=O)C1(CCN(CC#C)CC1)S(=O)(=O)c1ccc(Sc2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a