Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMatrix metalloproteinase-7 (MMP7)
LigandBDBM50343083
Substrate/Competitorn/a
Meas. Tech.ChEMBL_744952
Ki 970±n/a nM
Citation Barta, TEBecker, DPBedell, LJEaston, AMHockerman, SLKiefer, JMunie, GEMathis, KJLi, MHRico, JGVillamil, CIWilliams, JM MMP-13 selectivea-sulfone hydroxamates: a survey of P1' heterocyclic amide isosteres. Bioorg Med Chem Lett21:2820-2 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Matrix metalloproteinase-7 (MMP7)
Name:Matrix metalloproteinase 7
Synonyms:Matrix metalloproteinase 7 | Matrix metalloproteinase-7 (MMP-7)
Type:Enzyme
Mol. Mass.:29681.54
Organism:Homo sapiens (Human)
Description:P09237
Residue:267
Sequence:
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50343083
NameBDBM50343083
Synonyms:CHEMBL1771218 | N-hydroxy-4-(4-(3-(5-(5-methylpyridin-2-yl)-1H-tetrazol-1-yl)propoxy)phenylsulfonyl)tetrahydro-2H-pyran-4-carboxamide
TypeSmall organic molecule
Emp. Form.C22H26N6O6S
Mol. Mass.502.543
SMILESCc1ccc(nc1)-c1nnnn1CCCOc1ccc(cc1)S(=O)(=O)C1(CCOCC1)C(=O)NO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a