Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLow affinity sodium-glucose cotransporter
LigandBDBM50345022
Substrate/Competitorn/a
Meas. Tech.ChEMBL_749157
IC50 81.9±n/a nM
Citation Kang, SYKim, MJLee, JSLee, J Glucosides with cyclic diarylpolynoid as novel C-aryl glucoside SGLT2 inhibitors. Bioorg Med Chem Lett21:3759-63 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Low affinity sodium-glucose cotransporter
Name:Low affinity sodium-glucose cotransporter
Synonyms:Na(+)/glucose cotransporter 3 | Sodium/glucose cotransporter 3 | Solute carrier family 5 member 4
Type:PROTEIN
Mol. Mass.:72452.26
Organism:Homo sapiens (Human)
Description:ChEMBL_764617
Residue:659
Sequence:
MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKTNRGTIGGFFL
AGRDMAWWPMGASLFASNIGSNHYVGLAGTGAASGVATVTFEWTSSVMLLILGWIFVPIY
IKSGVMTMPEYLKKRFGGERLQVYLSILSLFICVVLLISADIFAGAIFIKLALGLDLYLA
IFILLAMTAVYTTTGGLASVIYTDTLQTIIMLIGSFILMGFAFNEVGGYESFTEKYVNAT
PSVVEGDNLTISASCYTPRADSFHIFRDAVTGDIPWPGIIFGMPITALWYWCTNQVIVQR
CLCGKDMSHVKAACIMCAYLKLLPMFLMVMPGMISRILYTDMVACVVPSECVKHCGVDVG
CTNYAYPTMVLELMPQGLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKMRKQASEK
ELLIAGRIFVLLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRV
NEQGAFWGLMVGLAMGLIRMITEFAYGTGSCLAPSNCPKIICGVHYLYFSIVLFFGSMLV
TLGISLLTKPIPDVHLYRLCWVLRNSTEERIDIDAEEKSQEETDDGVEEDYPEKSRGCLK
KAYDLFCGLQKGPKLTKEEEEALSKKLTDTSERPSWRTIVNINAILLLAVVVFIHGYYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50345022
NameBDBM50345022
Synonyms:(2R,3S,4R,5R,6S)-2-Hydroxymethyl-6-(15-oxa-tricyclo[14.2.2.0*3,8*]icosa-1(19),3(8),4,6,16(20),17-hexaen-5-yl)-tetrahydro-pyran-3,4,5-triol | CHEMBL1778794
TypeSmall organic molecule
Emp. Form.C25H32O6
Mol. Mass.428.518
SMILESOC[C@H]1O[C@H]([C@H](O)[C@@H](O)[C@@H]1O)c1ccc2CCCCCCOc3ccc(Cc2c1)cc3 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a