Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-X-C chemokine receptor type 4 (CXCR4)
LigandBDBM50225415
Substrate/Competitorn/a
Meas. Tech.ChEMBL_754437
IC50 1.8±n/a nM
Citation Zhu, AZhan, WLiang, ZYoon, YYang, HGrossniklaus, HEXu, JRojas, MLockwood, MSnyder, JPLiotta, DCShim, H Dipyrimidine amines: a novel class of chemokine receptor type 4 antagonists with high specificity. J Med Chem53:8556-68 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-X-C chemokine receptor type 4 (CXCR4)
Name:C-X-C chemokine receptor type 4
Synonyms:C-X-C chemokine receptor type 4 | CD_antigen=CD184 | CXC-R4 | CXCR-4 | FB22 | Fusin | HM89 | LCR1 | LESTR | Leukocyte-derived seven transmembrane domain receptor | NPYRL | SDF-1 receptor | Stromal cell-derived factor 1 receptor
Type:Enzyme
Mol. Mass.:39754.61
Organism:Homo sapiens (Human)
Description:P61073
Residue:352
Sequence:
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50225415
NameBDBM50225415
Synonyms:CHEMBL237830 | N,N'-di-2-pyridinyl-1,4-benzenedimethanamine | US9205085, MSX- 121 | WZ-811
TypeSmall organic molecule
Emp. Form.C18H18N4
Mol. Mass.290.3623
SMILESC(Nc1ccccn1)c1ccc(CNc2ccccn2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a