Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 9
LigandBDBM50348534
Substrate/Competitorn/a
Meas. Tech.ChEMBL_755002
IC50 2±n/a nM
Citation Revesz, LSchlapbach, AAichholz, RFeifel, RHawtin, SHeng, RHiestand, PJahnke, WKoch, GKroemer, MMöbitz, HScheufler, CVelcicky, JHuppertz, C In vivo and in vitro SAR of tetracyclic MAPKAP-K2 (MK2) inhibitors. Part I. Bioorg Med Chem Lett20:4715-8 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 9
Name:Mitogen-activated protein kinase 9
Synonyms:JNK-55 | JNK2/JNK3 | Mitogen-Activated Protein Kinase 9 (JNK2) | Stress-activated protein kinase JNK2 | c-Jun N-terminal kinase 2 | c-Jun N-terminal kinase 2 (JNK2)
Type:Enzyme
Mol. Mass.:48131.49
Organism:Homo sapiens (human)
Description:JNK-2 was purchased from Upstate Cell Signaling Solutions (formerly Upstate Biotechnology).
Residue:424
Sequence:
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50348534
NameBDBM50348534
Synonyms:CHEMBL1801373
TypeSmall organic molecule
Emp. Form.C21H15N3O
Mol. Mass.325.3633
SMILESO=C1NCc2[nH]c3c(ccc4cnc(\C=C\c5ccccc5)cc34)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a