Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKetohexokinase
LigandBDBM50349752
Substrate/Competitorn/a
Meas. Tech.ChEMBL_759463
IC50 860±n/a nM
Citation Zhang, XSong, FKuo, GHXiang, AGibbs, ACAbad, MCSun, WKuo, LCSui, Z Optimization of a pyrazole hit from FBDD into a novel series of indazoles as ketohexokinase inhibitors. Bioorg Med Chem Lett21:4762-7 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ketohexokinase
Name:Ketohexokinase
Synonyms:Hepatic fructokinase | Ketohexokinase (KHK)
Type:Enzyme
Mol. Mass.:32521.64
Organism:Homo sapiens (Human)
Description:P50053
Residue:298
Sequence:
MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFM
GSMAPGHVADFLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV
SATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELF
QLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLL
HSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50349752
NameBDBM50349752
Synonyms:CHEMBL1809179 | US8822447, 56 | US9771375, Example 56
TypeSmall organic molecule
Emp. Form.C20H24N4
Mol. Mass.320.4314
SMILESCCc1nn(-c2ccccc2)c2cc(ccc12)N1CCNC(C)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a