Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target15-Lipoxygenase-2 (15-LOX-2)
LigandBDBM32147
Substrate/Competitorn/a
Meas. Tech.ChEMBL_761396
IC50 28000±n/a nM
Citation Kenyon, VRai, GJadhav, ASchultz, LArmstrong, MJameson, JBPerry, SJoshi, NBougie, JMLeister, WTaylor-Fishwick, DANadler, JLHolinstat, MSimeonov, AMaloney, DJHolman, TR Discovery of potent and selective inhibitors of human platelet-type 12- lipoxygenase. J Med Chem54:5485-97 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
15-Lipoxygenase-2 (15-LOX-2)
Name:15-Lipoxygenase-2 (15-LOX-2)
Synonyms:15-LOX-2 | 15-Lipo-oxygenase type 2 (15-LOX-2) | 15-lipoxygenase 2 | Arachidonate 15-lipoxygenase type II | Arachidonate 15-lipoxygenase, type II | Arachidonate 15-lipoxygenase-2 | Epithelial 15-lipoxygenase-2
Type:Protein
Mol. Mass.:75850.40
Organism:Homo sapiens (Human)
Description:n/a
Residue:676
Sequence:
MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPED
VGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQE
GTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAK
NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFAS
QFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQT
NVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKWDWLLAKTWV
RNAEFSFHEALTHLLHSHLLPEVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELL
IVPGQVVDRSTGIGIEGFSELIQRNMKQLNYSLLCLPEDIRTRGVEDIPGYYYRDDGMQI
WGAVERFVSEIIGIYYPSDESVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQ
YVTMVIFTCSAKHAAVSAGQFDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNAT
CDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPRRSIATFQSRLAQISRGIQERNQGLVL
PYTYLDPPLIENSVSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM32147
NameBDBM32147
Synonyms:AS-229 | CHLOROXINE | cid_2722
TypeSmall organic molecule
Emp. Form.C9H5Cl2NO
Mol. Mass.214.048
SMILESOc1c(Cl)cc(Cl)c2cccnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a