Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAmine oxidase [flavin-containing] B
LigandBDBM50350637
Substrate/Competitorn/a
Meas. Tech.ChEMBL_762399
Ki 3±n/a nM
Citation Manley-King, CIBergh, JJPetzer, JP Inhibition of monoamine oxidase by C5-substituted phthalimide analogues. Bioorg Med Chem19:4829-40 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Amine oxidase [flavin-containing] B
Name:Monoamine oxidase
Synonyms:MAO-B | Monoamine oxidase type B | Monoamine oxidase type B (MAO B) | Monoamine oxidase type B (MAO B) | Monoamine oxidase type B (MAOB)
Type:Protein
Mol. Mass.:58768.76
Organism:Homo sapiens (Human)
Description:P27338
Residue:520
Sequence:
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50350637
NameBDBM50350637
Synonyms:CHEMBL1813523
TypeSmall organic molecule
Emp. Form.C15H10BrNO3
Mol. Mass.332.149
SMILESBrc1ccc(COc2ccc3C(=O)NC(=O)c3c2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a