Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLow affinity sodium-glucose cotransporter
LigandBDBM50351438
Substrate/Competitorn/a
Meas. Tech.ChEMBL_764617
IC50 110±n/a nM
Citation Ohtake, YSato, TMatsuoka, HNishimoto, MTaka, NTakano, KYamamoto, KOhmori, MHiguchi, TMurakata, MKobayashi, TMorikawa, KShimma, NSuzuki, MHagita, HOzawa, KYamaguchi, KKato, MIkeda, S 5a-Carba-ß-D-glucopyranose derivatives as novel sodium-dependent glucose cotransporter 2 (SGLT2) inhibitors for the treatment of type 2 diabetes. Bioorg Med Chem19:5334-41 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Low affinity sodium-glucose cotransporter
Name:Low affinity sodium-glucose cotransporter
Synonyms:Na(+)/glucose cotransporter 3 | Sodium/glucose cotransporter 3 | Solute carrier family 5 member 4
Type:PROTEIN
Mol. Mass.:72452.26
Organism:Homo sapiens (Human)
Description:ChEMBL_764617
Residue:659
Sequence:
MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKTNRGTIGGFFL
AGRDMAWWPMGASLFASNIGSNHYVGLAGTGAASGVATVTFEWTSSVMLLILGWIFVPIY
IKSGVMTMPEYLKKRFGGERLQVYLSILSLFICVVLLISADIFAGAIFIKLALGLDLYLA
IFILLAMTAVYTTTGGLASVIYTDTLQTIIMLIGSFILMGFAFNEVGGYESFTEKYVNAT
PSVVEGDNLTISASCYTPRADSFHIFRDAVTGDIPWPGIIFGMPITALWYWCTNQVIVQR
CLCGKDMSHVKAACIMCAYLKLLPMFLMVMPGMISRILYTDMVACVVPSECVKHCGVDVG
CTNYAYPTMVLELMPQGLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKMRKQASEK
ELLIAGRIFVLLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRV
NEQGAFWGLMVGLAMGLIRMITEFAYGTGSCLAPSNCPKIICGVHYLYFSIVLFFGSMLV
TLGISLLTKPIPDVHLYRLCWVLRNSTEERIDIDAEEKSQEETDDGVEEDYPEKSRGCLK
KAYDLFCGLQKGPKLTKEEEEALSKKLTDTSERPSWRTIVNINAILLLAVVVFIHGYYA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50351438
NameBDBM50351438
Synonyms:CHEMBL1817688
TypeSmall organic molecule
Emp. Form.C22H28O6
Mol. Mass.388.4541
SMILESCCOc1ccc(Cc2ccccc2O[C@@H]2C[C@H](CO)[C@@H](O)[C@H](O)[C@H]2O)cc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a