Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 9
LigandBDBM50352628
Substrate/Competitorn/a
Meas. Tech.ChEMBL_767487
IC50 17±n/a nM
Citation Bowers, STruong, APJeffrey Neitz, RHom, RKSealy, JMProbst, GDQuincy, DPeterson, BChan, WGalemmo, RAKonradi, AWSham, HLTóth, GPan, HLin, MYao, NArtis, DRZhang, HChen, LDryer, MSamant, BZmolek, WWong, KLorentzen, CGoldbach, ETonn, GQuinn, KPSauer, JMWright, SPowell, KRuslim, LRen, ZBard, FYednock, TAGriswold-Prenner, I Design and synthesis of brain penetrant selective JNK inhibitors with improved pharmacokinetic properties for the prevention of neurodegeneration. Bioorg Med Chem Lett21:5521-7 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Mitogen-activated protein kinase 9
Name:Mitogen-activated protein kinase 9
Synonyms:JNK-55 | JNK2/JNK3 | Mitogen-Activated Protein Kinase 9 (JNK2) | Stress-activated protein kinase JNK2 | c-Jun N-terminal kinase 2 | c-Jun N-terminal kinase 2 (JNK2)
Type:Enzyme
Mol. Mass.:48131.49
Organism:Homo sapiens (human)
Description:JNK-2 was purchased from Upstate Cell Signaling Solutions (formerly Upstate Biotechnology).
Residue:424
Sequence:
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50352628
NameBDBM50352628
Synonyms:CHEMBL1822309
TypeSmall organic molecule
Emp. Form.C20H11F3N4O2S2
Mol. Mass.460.452
SMILESFC(F)(F)c1ccc2n(CC(=O)Nc3scc(C#N)c3-c3cscn3)c(=O)ccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a