Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLuciferase
LigandBDBM50352641
Substrate/Competitorn/a
Meas. Tech.ChEMBL_766351
IC50 5±n/a nM
Citation Xiao, JMarugan, JJZheng, WTitus, SSouthall, NCherry, JJEvans, MAndrophy, EJAustin, CP Discovery, synthesis, and biological evaluation of novel SMN protein modulators. J Med Chem54:6215-33 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Luciferase
Name:Luciferase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:60126.66
Organism:Luciola lateralis
Description:ChEMBL_786225
Residue:548
Sequence:
MENMENDENIVYGPEPFYPIEEGSAGAQLRKYMDRYAKLGAIAFTNALTGVDYTYAEYLE
KSCCLGEALKNYGLVVDGRIALCSENCEEFFIPVLAGLFIGVGVAPTNEIYTLRELVHSL
GISKPTIVFSSKKGLDKVITVQKTVTAIKTIVILDSKVDYRGYQSMDNFIKKNTPQGFKG
SSFKTVEVNRKEQVALIMNSSGSTGLPKGVQLTHENAVTRFSHARDPIYGNQVSPGTAIL
TVVPFHHGFGMFTTLGYLTCGFRIVMLTKFDEETFLKTLQDYKCSSVILVPTLFAILNRS
ELLDKYDLSNLVEIASGGAPLSKEIGEAVARRFNLPGVRQGYGLTETTSAIIITPEGDDK
PGASGKVVPLFKAKVIDLDTKKTLGPNRRGEVCVKGPMLMKGYVDNPEATREIIDEEGWL
HTGDIGYYDEEKHFFIVDRLKSLIKYKGYQVPPAELESVLLQHPNIFDAGVAGVPDPIAG
ELPGAVVVLEKGKSMTEKEVMDYVASQVSNAKRLRGGVRFVDEVPKGLTGKIDGKAIREI
LKKPVAKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50352641
NameBDBM50352641
Synonyms:CHEMBL1733803
TypeSmall organic molecule
Emp. Form.C18H20N2O4S
Mol. Mass.360.427
SMILESOC(=O)C1CCN(CC1)c1ncc(s1)-c1ccc2OCCCOc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a