Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCannabinoid receptor 2
LigandBDBM50353092
Substrate/Competitorn/a
Meas. Tech.ChEMBL_767975
Ki 0.01±n/a nM
Citation Turkman, NShavrin, AIvanov, RARabinovich, BVolgin, AGelovani, JGAlauddin, MM Fluorinated cannabinoid CB2 receptor ligands: synthesis and in vitro binding characteristics of 2-oxoquinoline derivatives. Bioorg Med Chem19:5698-707 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cannabinoid receptor 2
Name:Cannabinoid receptor 2
Synonyms:CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:39690.94
Organism:Homo sapiens (Human)
Description:P34972
Residue:360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50353092
NameBDBM50353092
Synonyms:CHEMBL1822945
TypeSmall organic molecule
Emp. Form.C23H27N3O4
Mol. Mass.409.4782
SMILESCCCCCOc1c(OC)ccc2cc(C(=O)NCCc3ccncc3)c(=O)[nH]c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a