Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKinesin-like protein KIF23
LigandBDBM50353788
Substrate/Competitorn/a
Meas. Tech.ChEMBL_770434
IC50 50000±n/a nM
Citation Theoclitou, MEAquila, BBlock, MHBrassil, PJCastriotta, LCode, ECollins, MPDavies, AMDeegan, TEzhuthachan, JFilla, SFreed, EHu, HHuszar, DJayaraman, MLawson, DLewis, PMNadella, MVOza, VPadmanilayam, MPontz, TRonco, LRussell, DWhitston, DZheng, X Discovery of (+)-N-(3-aminopropyl)-N-[1-(5-benzyl-3-methyl-4-oxo-[1,2]thiazolo[5,4-d]pyrimidin-6-yl)-2-methylpropyl]-4-methylbenzamide (AZD4877), a kinesin spindle protein inhibitor and potential anticancer agent. J Med Chem54:6734-50 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kinesin-like protein KIF23
Name:Kinesin-like protein KIF23
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:110080.28
Organism:Homo sapiens (Human)
Description:ChEMBL_770434
Residue:960
Sequence:
MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNTTVQLHTPEGY
RLNRNGDYKETQYSFKQVFGTHTTQKELFDVVANPLVNDLIHGKNGLLFTYGVTGSGKTH
TMTGSPGEGGLLPRCLDMIFNSIGSFQAKRYVFKSNDRNSMDIQCEVDALLERQKREAMP
NPKTSSSKRQVDPEFADMITVQEFCKAEEVDEDSVYGVFVSYIEIYNNYIYDLLEEVPFD
PIKPKPPQSKLLREDKNHNMYVAGCTEVEVKSTEEAFEVFWRGQKKRRIANTHLNRESSR
SHSVFNIKLVQAPLDADGDNVLQEKEQITISQLSLVDLAGSERTNRTRAEGNRLREAGNI
NQSLMTLRTCMDVLRENQMYGTNKMVPYRDSKLTHLFKNYFDGEGKVRMIVCVNPKAEDY
EENLQVMRFAEVTQEVEVARPVDKAICGLTPGRRYRNQPRGPVGNEPLVTDVVLQSFPPL
PSCEILDINDEQTLPRLIEALEKRHNLRQMMIDEFNKQSNAFKALLQEFDNAVLSKENHM
QGKLNEKEKMISGQKLEIERLEKKNKTLEYKIEILEKTTTIYEEDKRNLQQELETQNQKL
QRQFSDKRRLEARLQGMVTETTMKWEKECERRVAAKQLEMQNKLWVKDEKLKQLKAIVTE
PKTEKPERPSRERDREKVTQRSVSPSPVPLSSNYIAQISNGQQLMSQPQLHRRSNSCSSI
SVASCISEWEQKIPTYNTPLKVTSIARRRQQEPGQSKTCIVSDRRRGMYWTEGREVVPTF
RNEIEIEEDHCGRLLFQPDQNAPPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPH
AITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETLKQ
ESPNGSRKRRSSTVAPAQPDGAESEWTDVETRCSVAVEMRAGSQLGPGYQHHAQPKRKKP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50353788
NameBDBM50353788
Synonyms:CHEMBL1829433
TypeSmall organic molecule
Emp. Form.C28H33N5O2S
Mol. Mass.503.659
SMILESCC(C)C(N(CCCN)C(=O)c1ccc(C)cc1)c1nc2snc(C)c2c(=O)n1Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a