Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCorticotropin releasing factor receptor 1
LigandBDBM50354031
Substrate/Competitorn/a
Meas. Tech.ChEMBL_770317
EC50 5.6±n/a nM
Citation Saito, TObitsu, TMinamoto, CSugiura, TMatsumura, NUeno, SKishi, AKatsumata, SNakai, HToda, M Pyrazolo[1,5-a]pyrimidines, triazolo[1,5-a]pyrimidines and their tricyclic derivatives as corticotropin-releasing factor 1 (CRF¿?) receptor antagonists. Bioorg Med Chem19:5955-66 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Corticotropin releasing factor receptor 1
Name:Corticotropin releasing factor receptor 1
Synonyms:CRF-R | CRF-R2 Alpha | CRF1 | CRH-R 1 | CRHR1 | Corticotropin-releasing factor receptor 1 (CRF-1) | Corticotropin-releasing factor receptor 1 (CRF1) | Corticotropin-releasing hormone receptor 1
Type:Enzyme
Mol. Mass.:50744.31
Organism:Homo sapiens (Human)
Description:P34998
Residue:444
Sequence:
MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRPGCTHWGDQADGALEVGAPWSGAPFQVRRSIRCLR
NIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGC
YLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYI
YQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFF
VNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARV
ARAMSIPTSPTRVSFHSIKQSTAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50354031
NameBDBM50354031
Synonyms:CHEMBL1830528
TypeSmall organic molecule
Emp. Form.C22H26N4O2
Mol. Mass.378.4674
SMILESCCC(CC)n1ccc2c(Oc3ccc(CC)cc3OC)nc3ccnn3c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a