Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCorticotropin releasing factor receptor
LigandBDBM50354035
Substrate/Competitorn/a
Meas. Tech.ChEMBL_770318
EC50 81±n/a nM
Citation Saito, TObitsu, TMinamoto, CSugiura, TMatsumura, NUeno, SKishi, AKatsumata, SNakai, HToda, M Pyrazolo[1,5-a]pyrimidines, triazolo[1,5-a]pyrimidines and their tricyclic derivatives as corticotropin-releasing factor 1 (CRF¿?) receptor antagonists. Bioorg Med Chem19:5955-66 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Corticotropin releasing factor receptor
Name:Corticotropin releasing factor receptor
Synonyms:CRF-R | CRF1 | CRH-R 1 | CRHR1 | Corticotropin releasing factor receptor 1 | Corticotropin-releasing Factor Receptor 1 | Corticotropin-releasing hormone receptor 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:47870.75
Organism:Rattus norvegicus (rat)
Description:Receptor binding assays were performed using rat cortex homogenate.
Residue:415
Sequence:
MGRRPQLRLVKALLLLGLNPVSTSLQDQRCENLSLTSNVSGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEV
HQSNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPF
PIIVAWAIGKLHYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRA
STTSETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVS
VFYCFLNSEVRSAIRKRWRRWQDKHSIRARVARAMSIPTSPTRVSFHSIKQSTAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50354035
NameBDBM50354035
Synonyms:CHEMBL1828889
TypeSmall organic molecule
Emp. Form.C20H26ClN5O
Mol. Mass.387.906
SMILESCCCN(CCC)c1c(C)c(Nc2ccc(OC)cc2Cl)nc2ccnn12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a