Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcetylpolyamine amidohydrolase (APAH)
LigandBDBM50121062
Substrate/Competitorn/a
Meas. Tech.ChEMBL_771085
IC50 110000±n/a nM
Citation Ilies, MDowling, DPLombardi, PMChristianson, DW Synthesis of a new trifluoromethylketone analogue of l-arginine and contrasting inhibitory activity against human arginase I and histone deacetylase 8. Bioorg Med Chem Lett21:5854-8 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acetylpolyamine amidohydrolase (APAH)
Name:Acetylpolyamine amidohydrolase (APAH)
Synonyms:Acetylpolyamine aminohydrolase
Type:Protein
Mol. Mass.:36324.64
Organism:Mycoplana ramosa (Gram-negative bacterium)
Description:n/a
Residue:341
Sequence:
MRVIFSEDHKLRNAKTELYGGELVPPFEAPFRAEWILAAVKEAGFDDVVAPARHGLETVL
KVHDAGYLNFLETAWDRWKAAGYKGEAIATSFPVRRTSPRIPTDIEGQIGYYCNAAETAI
SPGTWEAALSSMASAIDGADLIAAGHKAAFSLCRPPGHHAGIDMFGGYCFINNAAVAAQR
LLDKGAKKIAILDVDFHHGNGTQDIFYERGDVFFASLHGDPAEAFPHFLGYAEETGKGAG
AGTTANYPMGRGTPYSVWGEALTDSLKRIAAFGAEAIVVSLGVDTFEQDPISFFKLTSPD
YITMGRTIAASGVPLLVVMEGGYGVPEIGLNVANVLKGVAG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50121062
NameBDBM50121062
Synonyms:9,9,9-TRIFLUORO-8-OXO-N-PHENYLNONANAMIDE | 9,9,9-Trifluoro-8-oxo-nonanoic acid phenylamide | CHEMBL113537
TypeSmall organic molecule
Emp. Form.C15H18F3NO2
Mol. Mass.301.3041
SMILESFC(F)(F)C(=O)CCCCCCC(=O)Nc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a