Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
LigandBDBM50283498
Substrate/Competitorn/a
Meas. Tech.ChEMBL_772123
IC50 12000±n/a nM
Citation Tang, MOdejinmi, SIAllette, YMVankayalapati, HLai, K Identification of novel small molecule inhibitors of 4-diphosphocytidyl-2-C-methyl-D-erythritol (CDP-ME) kinase of Gram-negative bacteria. Bioorg Med Chem19:5886-95 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Name:4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Synonyms:4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase | CMK
Type:PROTEIN
Mol. Mass.:32675.02
Organism:Yersinia pestis
Description:ChEMBL_772123
Residue:299
Sequence:
MTTANQPICPSPAKWPSPAKLNLFLYITGQRADGYHQLQTLFQFLDYGDQLTIEPRDDNQ
IRLLTPIAGVENEQNLIVRAAKMLQKHPGNTPVPRGADISIDKCLPMGGGLGGGSSNAAT
VLVALNLLWQCGLTDEQLADLGLTLGADVPVFVRGHAAFAEGIGEKLQPAEPVEKWYLVI
HPGVNIPTPIIFSDPELKRNTPIRPLAALLSTPYANDCEPIARKRFREVEQALSWLLEYA
PSRLTGTGACVFAEFDTESSARQVLSIAPEWLHGFVARGVNVSPLHRVRSGKIESSERR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50283498
NameBDBM50283498
Synonyms:4-[1-Furan-2-yl-meth-(Z)-ylidene]-3-phenyl-4H-isoxazol-5-one | CHEMBL80658 | cid_1834885
TypeSmall organic molecule
Emp. Form.C14H9NO3
Mol. Mass.239.2262
SMILESO=C1ON=C(\C1=C\c1ccco1)c1ccccc1 |c:3|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a